Protein Info for JDDGAC_21710 in Escherichia coli ECRC98

Name: yhbX
Annotation: Putative transferase YhbX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 76 to 95 (20 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details PF00884: Sulfatase" amino acids 188 to 431 (244 residues), 191.6 bits, see alignment E=1e-60

Best Hits

Swiss-Prot: 100% identical to YHBX_ECO57: Putative transferase YhbX (yhbX) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to ece:Z4535)

Predicted SEED Role

"Outer-membrane protein yhbX precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (505 amino acids)

>JDDGAC_21710 Putative transferase YhbX (Escherichia coli ECRC98)
MVQRLLFFVLTILVVKRISSLPLRLLVAAPFVLLTAADMSISLYSWCTFGTTFNDGFAIS
VLQSDPDEVAKMLGMYSPYLCAFAFLSLLFLAVIIKYDVSLPTKKVTGILLLIVISGSLF
SACQFAYKDAKNKNAFSPYILASRFATYTPFFNLNYFALAAKEHQRLLSIANTVPYFQLS
VRDTGIDTYVLIVGESVRVDNMSLYGYTRSTTPQVEAQRKQIKLFNQAISGAPYTALSVP
LSLTADSVLSHDIHNYPDNIINMANQAGFQTFWLSSQSAFRQNGTAVTSIAMRAMETVYV
RGFDELLLPHLSQALQQNTQQKKLIVLHLNGSHEPACSAYPQSSAVFQPQDDQDACYDNS
IHYTDSLLGQVFELLKDRRASVMYFADHGLERDPTKKNVYFHGGREASQQAYHVPMFIWY
SPVLGDGVDRTTENNIFSTAYNNYLINAWMGVTKPEQPQTLEEVIVHYKGDSLVVDANHD
VFDYVMLRKEFTEDKQGNPTPEGQG