Protein Info for JDDGAC_21640 in Escherichia coli ECRC98

Name: ispB
Annotation: octaprenyl diphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to ISPB_ECOLI: Octaprenyl diphosphate synthase (ispB) from Escherichia coli (strain K12)

KEGG orthology group: K02523, octaprenyl-diphosphate synthase [EC: 2.5.1.90] (inferred from 100% identity to eco:b3187)

MetaCyc: 100% identical to all-trans-octaprenyl-diphosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-8992 [EC: 2.5.1.90]

Predicted SEED Role

"Octaprenyl diphosphate synthase (EC 2.5.1.90)" (EC 2.5.1.90)

MetaCyc Pathways

superpathway of chorismate metabolism (54/59 steps found)
superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
polyisoprenoid biosynthesis (E. coli) (5/5 steps found)
octaprenyl diphosphate biosynthesis (1/1 steps found)
superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
superpathway of menaquinol-8 biosynthesis II (2/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.90

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>JDDGAC_21640 octaprenyl diphosphate synthase (Escherichia coli ECRC98)
MNLEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVG
YEGNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAF
QMMTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQ
CSGILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPL
LHAMHHGTPEQAQMIRTAIEQGNGRHLLKPVLEAMNACGSLEWTRQRAEEEADKAIAALQ
VLPDTPWREALIGLAHIAVQRDR