Protein Info for JDDGAC_21535 in Escherichia coli ECRC98

Name: mtgA
Annotation: monofunctional biosynthetic peptidoglycan transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details TIGR02070: monofunctional biosynthetic peptidoglycan transglycosylase" amino acids 13 to 231 (219 residues), 281.2 bits, see alignment E=2.8e-88 PF00912: Transgly" amino acids 61 to 227 (167 residues), 178.7 bits, see alignment E=3.9e-57

Best Hits

Swiss-Prot: 100% identical to MTGA_ECO57: Biosynthetic peptidoglycan transglycosylase (mtgA) from Escherichia coli O157:H7

KEGG orthology group: K03814, monofunctional biosynthetic peptidoglycan transglycosylase [EC: 2.4.1.-] (inferred from 100% identity to etw:ECSP_4183)

MetaCyc: 99% identical to peptidoglycan glycosyltransferase MtgA (Escherichia coli K-12 substr. MG1655)
Peptidoglycan glycosyltransferase. [EC: 2.4.1.129]

Predicted SEED Role

"Monofunctional biosynthetic peptidoglycan transglycosylase (EC 2.4.2.-)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-, 2.4.1.129, 2.4.2.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.129 or 2.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>JDDGAC_21535 monofunctional biosynthetic peptidoglycan transglycosylase (Escherichia coli ECRC98)
MSKSRLTVFSFVRRFLLRLMVVLAVFWGGGIALFSVAPVPFSAVMVERQVSAWLHGNFRY
VAHSDRVSMDQISPWMGLAVIAAEDQTFPEHWGFDVASIEKALAHNERNENRIRGASTIS
QQTAKNLFLWDGRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGVFGVEAAAQR
YFHKPASKLTRSEAALLAAVLPNPLRFKVSAPSGYVRSRQAWILRQMYQLGGEPFMQQHQ
LD