Protein Info for JDDGAC_21290 in Escherichia coli ECRC98

Name: acrS
Annotation: multidrug efflux transporter transcriptional repressor AcrS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF00440: TetR_N" amino acids 16 to 62 (47 residues), 64.2 bits, see alignment 1.1e-21 PF08361: TetR_C_2" amino acids 84 to 202 (119 residues), 165.9 bits, see alignment E=6.2e-53 PF08359: TetR_C_4" amino acids 139 to 193 (55 residues), 24.8 bits, see alignment E=3.2e-09

Best Hits

Swiss-Prot: 100% identical to ENVR_ECO57: Probable acrEF/envCD operon repressor (envR) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b3264)

Predicted SEED Role

"Transcription repressor of multidrug efflux pump acrAB operon, TetR (AcrR) family" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>JDDGAC_21290 multidrug efflux transporter transcriptional repressor AcrS (Escherichia coli ECRC98)
MAKRTKAEALKTRQELIETAIAQFAQHGVSKTTLNDIADAANVTRGAIYWHFENKTQLFN
EMWLQQPSLRELIQEHLTAGLEHDPFQQLREKLIVGLQYIAKIPRQQALLKILYHKCEFN
DEMLAEGVIREKMGFNPQTLREVLQACQQQGCVANNLDLDVVMIIIDGAFSGIVQNWLMN
MAGYDLYKQAPALVDNVLRMFMPDENITKLIHQTNELSVM