Protein Info for JDDGAC_21275 in Escherichia coli ECRC98

Name: adeB
Annotation: hydrophobe/amphiphile efflux-1 family RND transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 248 to 267 (20 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details amino acids 350 to 367 (18 residues), see Phobius details amino acids 378 to 404 (27 residues), see Phobius details PF00873: ACR_tran" amino acids 1 to 405 (405 residues), 550.4 bits, see alignment E=7.5e-169 PF02355: SecD_SecF" amino acids 246 to 394 (149 residues), 24.6 bits, see alignment E=1.5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to ece:Z4627)

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>JDDGAC_21275 hydrophobe/amphiphile efflux-1 family RND transporter (Escherichia coli ECRC98)
MAFVSLKPWEERNGDENSAEAVIHRAKMELGKIRDGFVIPFNMPAIVELGTATGFDFELI
DKAGLGHDALTQARNQLLGMAAQHPASLVSVRPNGLEDTAQFKLEVDQEKAQALGVSLSD
INQTISTALGGTYVNDFIDRGRVKKVYVQADAKFRMLPEDVDKLYVRSTNGEMVPFSAFT
TSHWVYGSPRLERYNGLPSMEIQGEAAPGTSSGDAMALMENLASKLPAGIGYDWTGMSYQ
ERLSGNQAPALVAISFVVVFLCLAALYESWSIPVSVMLVVPLGIVGVLLAATLFNQKNDV
YFMVGLLTTIGLSAKNAILIVEFAKDLMEKEGKGVVEATLMAVRMRLRPILMTSLAFILG
VLPLAISNGAGSGAQNAVGIGVMGGMVSATLLAIFFVPVFFVVIRRCFKG