Protein Info for JDDGAC_21150 in Escherichia coli ECRC98

Name: rsmB
Annotation: 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01029: NusB
  • amino acids 6 to 127 (122 residues), 97.8 bits, E=1.4e-31
• TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase
  • amino acids 8 to 429 (422 residues), 649.2 bits, E=1.9e-199
• PF01189: Methyltr_RsmB-F
  • amino acids 239 to 426 (188 residues), 273.9 bits, E=1.6e-85
• PF13847: Methyltransf_31
  • amino acids 246 to 382 (137 residues), 31.9 bits, E=2.1e-11
• PF01728: FtsJ
  • amino acids 246 to 371 (126 residues), 25.7 bits, E=2.1e-09

Best Hits

Swiss-Prot: 100% identical to RSMB_ECO5E: Ribosomal RNA small subunit methyltransferase B (rsmB) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to ecs:ECs4154)

MetaCyc: 99% identical to 16S rRNA m5C967 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11591 [EC: 2.1.1.176]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.176

Protein Sequence (429 amino acids)

>JDDGAC_21150 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB (Escherichia coli ECRC98)
MKKQRNLRSMAAQAVEQVVEQGQSLSNILPPLQQKVSDKDKALLQELCFGVLRTLSQLDW
LINKSMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQLKGLING
VLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPMWLRINR
THHSRDTWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDASAQGCMT
WLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRLGMKATVK
QGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQSEILDAI
WPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELCETGTPEQPGKQNLPGAEEGDG
FFYAKLIKK