Protein Info for JDDGAC_20935 in Escherichia coli ECRC98

Name: tusD
Annotation: sulfurtransferase complex subunit TusD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02635: DsrE" amino acids 1 to 128 (128 residues), 94.9 bits, see alignment E=2e-31 TIGR03012: sulfur relay protein TusD/DsrE" amino acids 2 to 128 (127 residues), 181.9 bits, see alignment E=2.1e-58

Best Hits

Swiss-Prot: 100% identical to TUSD_ECO57: Sulfurtransferase TusD (tusD) from Escherichia coli O157:H7

KEGG orthology group: K07235, tRNA 2-thiouridine synthesizing protein D [EC: 2.8.1.-] (inferred from 96% identity to eco:b3345)

MetaCyc: 96% identical to sulfurtransferase complex subunit TusD (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusD"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (128 amino acids)

>JDDGAC_20935 sulfurtransferase complex subunit TusD (Escherichia coli ECRC98)
MRFAIVVTGPAYGTQQASSAFQFAQALIAEGHKLSSVFFYREGVYNANHLTSPASDEFDL
VRGWQQLNAQHGVALNICVAAALRRGVVDEMEAGRLGLASSNLQQGFTLSGLGALAEASL
TCDRVVQF