Protein Info for JDDGAC_20930 in Escherichia coli ECRC98

Name: yheO
Annotation: Uncharacterized protein YheO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF08348: PAS_6" amino acids 29 to 137 (109 residues), 125 bits, see alignment E=1.4e-40 PF13309: HTH_22" amino acids 171 to 228 (58 residues), 69.6 bits, see alignment E=1.9e-23

Best Hits

Swiss-Prot: 100% identical to YHEO_ECOLI: Uncharacterized protein YheO (yheO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3346)

Predicted SEED Role

"YheO-like PAS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>JDDGAC_20930 Uncharacterized protein YheO (Escherichia coli ECRC98)
MSRSLLTNETSELDLLDQRPFEQTDFDILKSYEAVVDGLAMLIGSHCEIVLHSLQDLKCS
AIRIANGEHTGRKIGSPITDLALRMLHDMTGADSSVSKCYFTRAKSGVLMKSLTIAIRNR
EQRVIGLLCINMNLDVPFSQIMSTFVPPETPDVGSSVNFASSVEDLVTQTLEFTIEEVNA
DRNVSNNAKNRQIVLNLYEKGIFDIKDAINQVADRLNISKHTVYLYIRQFKSGDFQGQDK