Protein Info for JDDGAC_20695 in Escherichia coli ECRC98

Name: yrfG
Annotation: GMP/IMP nucleotidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF00702: Hydrolase" amino acids 10 to 186 (177 residues), 77.5 bits, see alignment E=2.9e-25 PF13419: HAD_2" amino acids 13 to 190 (178 residues), 40 bits, see alignment E=7.1e-14 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 13 to 191 (179 residues), 68.9 bits, see alignment E=2.9e-23 PF12710: HAD" amino acids 13 to 137 (125 residues), 29.3 bits, see alignment E=1.7e-10

Best Hits

Swiss-Prot: 100% identical to YRFG_ECOLI: GMP/IMP nucleotidase YrfG (yrfG) from Escherichia coli (strain K12)

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to eco:b3399)

MetaCyc: 100% identical to purine nucleotidase (Escherichia coli K-12 substr. MG1655)
5'-nucleotidase. [EC: 3.1.3.5, 3.1.3.99]; 3.1.3.5 [EC: 3.1.3.5, 3.1.3.99]

Predicted SEED Role

"FIG001957: putative hydrolase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5 or 3.1.3.99

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>JDDGAC_20695 GMP/IMP nucleotidase (Escherichia coli ECRC98)
MHINIAWQDVDTVLLDMDGTLLDLAFDNYFWQKLVPETWGAKNGVTPQEAMEYMRQQYHD
VQHTLNWYCLDYWSEQLGLDICAMTTEMGPRAVLREDTIPFLEALKASGKQRILLTNAHP
HNLAVKLEHTGLDAHLDLLLSTHTFGYPKEDQRLWHAVAEATGLKAERTLFIDDSEAILD
AAAQFGIRYCLGVTNPDSGIAEKQYQRHPSLNDYRRLIPSLM