Protein Info for JDDGAC_20585 in Escherichia coli ECRC98

Name: rtcA
Annotation: RNA 3'-terminal phosphate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR03399: RNA 3'-phosphate cyclase" amino acids 5 to 324 (320 residues), 399.3 bits, see alignment E=6.7e-124 PF01137: RTC" amino acids 12 to 325 (314 residues), 270.1 bits, see alignment E=1.2e-84 PF05189: RTC_insert" amino acids 184 to 274 (91 residues), 48.2 bits, see alignment E=1.3e-16

Best Hits

Swiss-Prot: 100% identical to RTCA_ECO57: RNA 3'-terminal phosphate cyclase (rtcA) from Escherichia coli O157:H7

KEGG orthology group: K01974, RNA 3'-terminal phosphate cyclase [EC: 6.5.1.4] (inferred from 100% identity to ecf:ECH74115_4728)

MetaCyc: 97% identical to RNA 3'-terminal phosphate cyclase (Escherichia coli K-12 substr. MG1655)
RNA-3'-phosphate cyclase. [EC: 6.5.1.4]; 2.7.7.- [EC: 6.5.1.4]; 2.7.7.- [EC: 6.5.1.4]

Predicted SEED Role

"RNA 3'-terminal phosphate cyclase (EC 6.5.1.4)" in subsystem RNA 3'-terminal phosphate cyclase (EC 6.5.1.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.5.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>JDDGAC_20585 RNA 3'-terminal phosphate cyclase (Escherichia coli ECRC98)
MKRMIALDGAQGEGGGQIMRSALSLSMITGQPFTITGIRAGRAKPGLLRQHLTAVKAATE
ICGATVEGAELGSQRLVFRPGTVRGGDYRFAIGSAGSCTLVLQTVLPALWFADGPSRVEV
SGGTDNPSAPPADFIRRVLEPLLAKIGIHQQTTLLRHGFYPAGGGVVATEVSPVASFNTL
QLGERGNIVQMRGEVLLAGVPRHVAEREIATLAASFSLHEQNIHNLPRDQGPGNTVSLEV
ESENITERFFVVGEKRVSAEVVAAQLVKEVKRYLASPAAVGEYLADQLVLPMALAGAGQF
TVAHPSCHLLTNIAVVERFLPVRFTLAETDGVTRVMITKLTD