Protein Info for JDDGAC_20550 in Escherichia coli ECRC98

Annotation: Ybl142

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 29 to 49 (21 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 151 to 168 (18 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to eok:G2583_4126)

Predicted SEED Role

"Hypothetical membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>JDDGAC_20550 Ybl142 (Escherichia coli ECRC98)
MMNIIRLYIYPLFLGFVIVPLLVWPTVVALAACVITLSFLGEILFSIPLMHRRISLLQLQ
LWLSAEYALFFCAMVGVGWQFARRTPPELKSRLHCWLVFAPVYFWLLLWNIIFYVAPAQI
ALLENMRSFFLTVVWLPLNFSPFWSQQWIDFVGPISAQLGFALGYYCQWRSKNRSQIRKW
SEWGTCLSFVTLGMMAWALR