Protein Info for JDDGAC_20225 in Escherichia coli ECRC98

Name: fadM
Annotation: 4-hydroxybenzoyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13279: 4HBT_2
  • amino acids 16 to 131 (116 residues), 61.8 bits, E=9.2e-21
• PF03061: 4HBT
  • amino acids 23 to 102 (80 residues), 34.1 bits, E=2.8e-12

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 99% identity to efe:EFER_3459)

Predicted SEED Role

"FIG002571: 4-hydroxybenzoyl-CoA thioesterase domain protein"

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Protein Sequence (140 amino acids)

>JDDGAC_20225 4-hydroxybenzoyl-CoA thioesterase (Escherichia coli ECRC98)
VLNDPRFTAEVELTIPFHDVDMMGVAWHGNYFRYFEVAREALLNQFNYGYRQMKESGYLW
PVVDARVKYRHALTFEQRIRVRAHIEEFENRLRIGYQIFDAETGKRATTGYTIQVAVDEQ
SRELCFVSPDILFERMGVKP