Protein Info for JDDGAC_20175 in Escherichia coli ECRC98

Name: nikB
Annotation: nickel ABC transporter permease subunit NikB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 135 to 161 (27 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 275 to 299 (25 residues), see Phobius details TIGR02789: nickel ABC transporter, permease subunit NikB" amino acids 1 to 314 (314 residues), 561.9 bits, see alignment E=2.1e-173 PF19300: BPD_transp_1_N" amino acids 1 to 105 (105 residues), 37.7 bits, see alignment E=2e-13 PF00528: BPD_transp_1" amino acids 117 to 308 (192 residues), 162 bits, see alignment E=1.4e-51

Best Hits

Swiss-Prot: 99% identical to NIKB_ECOLI: Nickel transport system permease protein NikB (nikB) from Escherichia coli (strain K12)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 99% identity to eco:b3477)

MetaCyc: 99% identical to nickel ABC transporter membrane subunit NikB (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Nickel transport system permease protein NikB (TC 3.A.1.5.3)" in subsystem Transport of Nickel and Cobalt (TC 3.A.1.5.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>JDDGAC_20175 nickel ABC transporter permease subunit NikB (Escherichia coli ECRC98)
MLRYVLRRFLLLIPMVLAASVIIFLMLRLGTGDPALDYLRLSNLPPTPEMLASTRTMLGL
DQPLYVQYGTWLWKALHLDFGISFATQRPVLDDMLNFLPATLELAGAALVLILLTSVPLG
IWAARHRDRLPDFAVRFIAFLGVSMPNFWLAFLLVMAFSVYLQWLPAMGYGGWQHIILPA
VSIAFMSLAINARLLRASMLDVAGQRHVTWARLRGLNDKQTERRHILRNASLPMITAVGM
HIGELIGGTMIIENIFTWPGVGRYAVSAIFNRDYPVIQCFTLMMVVVFVVCNLIVDLLNA
ALDPRIRRHEGAHA