Protein Info for JDDGAC_20160 in Escherichia coli ECRC98

Name: nikE
Annotation: nickel import ATP-binding protein NikE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 TIGR02769: nickel import ATP-binding protein NikE" amino acids 2 to 265 (264 residues), 447.4 bits, see alignment E=8.8e-139 PF00005: ABC_tran" amino acids 28 to 179 (152 residues), 140.1 bits, see alignment E=3.9e-45

Best Hits

Swiss-Prot: 100% identical to NIKE_ECO57: Nickel import ATP-binding protein NikE (nikE) from Escherichia coli O157:H7

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to eok:G2583_4201)

MetaCyc: 96% identical to nickel ABC transporter ATP binding subunit NikE (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Nickel transport ATP-binding protein NikE (TC 3.A.1.5.3)" in subsystem Transport of Nickel and Cobalt (TC 3.A.1.5.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>JDDGAC_20160 nickel import ATP-binding protein NikE (Escherichia coli ECRC98)
MTLLNVSDLSHHYAHGGFSGKHQHQAVLNNVSLTLKSGETVALLGRSGCGKSTLSRLLVG
LESPSQGNISWRGESLAKLNRAQRKAFRRDIQMVFQDSISAVNPRKTVREILREPMRHLL
SLKKSEQLARASEMLHAVDLDDSVLDKRPPQLSGGQLQRVCLARALAVEPKLLILDEAVS
NLDLVLQAGVIRLLKKLQQQFGTACLFITHDLRLVERFCQRVMVMDNGQIVETQAVGEKL
TFSSDAGRVLQNAILPAFPVRRRATEKV