Protein Info for JDDGAC_20145 in Escherichia coli ECRC98

Name: ptsN
Annotation: PTS suar transporter subunit IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF00359: PTS_EIIA_2" amino acids 6 to 149 (144 residues), 116.2 bits, see alignment E=6e-38

Best Hits

KEGG orthology group: K02773, PTS system, galactitol-specific IIA component [EC: 2.7.1.69] (inferred from 97% identity to eum:ECUMN_3964)

Predicted SEED Role

"Putative carbohydrate PTS system, IIA component (EC 2.7.1.69)" (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>JDDGAC_20145 PTS suar transporter subunit IIA (Escherichia coli ECRC98)
MQGIHFQENYIQRLPAGLSVEQIIRQLAQPLVAAELVVPDFADHVLKREATYPTGLPTEP
PCVAIPHTDHKHVRHNAIAVGILPEPVEFADMGGDPDPVPVRVIFLLALSESNKQLNALG
WIMEMIQDTPFMQALLAMETTEIHTVILNKMKERGEI