Protein Info for JDDGAC_19995 in Escherichia coli ECRC98

Name: slp
Annotation: outer membrane lipoprotein Slp

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00752: outer membrane lipoprotein, Slp family" amino acids 2 to 183 (182 residues), 300.7 bits, see alignment E=1.3e-94 PF03843: Slp" amino acids 16 to 166 (151 residues), 142.4 bits, see alignment E=3.8e-46

Best Hits

Swiss-Prot: 100% identical to SLP_ECOLI: Outer membrane protein Slp (slp) from Escherichia coli (strain K12)

KEGG orthology group: K07285, outer membrane lipoprotein (inferred from 100% identity to ecq:ECED1_4175)

Predicted SEED Role

"Starvation lipoprotein Slp"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>JDDGAC_19995 outer membrane lipoprotein Slp (Escherichia coli ECRC98)
MNMTKGALILSLSFLLAACSSIPQNIKGNNQPDIQKSFVAVHNQPGLYVGQQARFGGKVI
NVINGKTDTLLEIAVLPLDSYAKPDIEANYQGRLLARQSGFLDPVNYRNHFVTILGTIQG
EQPGFINKVPYNFLEVNMQGIQVWHLREVVNTTYNLWDYGYGAFWPEPGWGAPYYTNAVS
QVTPELVK