Protein Info for JDDGAC_19705 in Escherichia coli ECRC98

Name: lpfD
Annotation: putative minor fimbrial subunit LpfD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00419: Fimbrial" amino acids 198 to 349 (152 residues), 78.2 bits, see alignment E=4.3e-26

Best Hits

Swiss-Prot: 100% identical to LPFD_ECO57: Probable minor fimbrial subunit LpfD (lpfD) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to ecs:ECs4427)

Predicted SEED Role

"Putative fimbrial protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>JDDGAC_19705 putative minor fimbrial subunit LpfD (Escherichia coli ECRC98)
MKAAIALSLLGCVFGFSGKAFAGDAWGPCTPADGTTYHYNVDVDVGIPDAAKNVAGTVLP
DVLNWSNGQNVSLICECPDSYKNEKDTLVQGVSMLPPSGRTVDSMKYYTLTEELEVATNI
RISTSVYGFVPFKNQQALQTTGCNKVITTPYMGGAGLLSFAITKPFIGDSVIPLTLIAEL
YASKTNKDYGTIPISSVSIQGRVTVTQDCEIKPGTVLDVPFGEFPSSAFKNRQGQMPEGA
TEQEINLSFDCNNISDGIKVALRLEGATNADDPRAVDMGNPDIGVLVKDSSGKILVPNDS
SSTTLLNLSSLDSKTHRNAAIRLLALPISTTGKAPKGGTFEGVTTIYLEME