Protein Info for JDDGAC_19040 in Escherichia coli ECRC98

Name: sepL
Annotation: type III secretion system LEE gatekeeper SepL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF07201: HrpJ" amino acids 56 to 211 (156 residues), 74.8 bits, see alignment E=1e-24 TIGR02511: type III secretion effector delivery regulator, TyeA family" amino acids 272 to 348 (77 residues), 68.7 bits, see alignment E=2.1e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_5052)

Predicted SEED Role

"Type III secretion cytoplasmic protein (YscL)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>JDDGAC_19040 type III secretion system LEE gatekeeper SepL (Escherichia coli ECRC98)
MANGIEFNQNPASVFNSNSLDFELESQQLTQKNSSNISSPLINLQNELAMITSSSLSETI
EGLSLGYRKGSARKEEEGSTIEKLLNDMQELLTLTDSDKIKELSLKNSGLLEQHDPTLAM
FGNMPKGEIVALISSLLQSKFVKIELKKKYARLLLDLLGEDDWELALLSWLGVGELNQEG
IQKIKKLYEKAKDEDSENGASLLDWFMEIKDLPEREKHLKVIIRALSFDLSYMSSFEDKV
KTSSIISDLCRVIIFLSLDNYADIISISIKKDKDIILNEVLSIIEHVWLTEDWLLESPSR
VSIVEDKHIYYFHLLKDFFTSLPDACFIDSEQRENALLMIGKVIDYKEEII