Protein Info for JDDGAC_18185 in Escherichia coli ECRC98

Name: rffG
Annotation: dTDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 3 to 341 (339 residues), 542.6 bits, see alignment E=1.4e-167 PF04321: RmlD_sub_bind" amino acids 3 to 266 (264 residues), 54.7 bits, see alignment E=2.5e-18 PF02719: Polysacc_synt_2" amino acids 4 to 114 (111 residues), 58.4 bits, see alignment E=2.1e-19 PF01370: Epimerase" amino acids 4 to 252 (249 residues), 252.5 bits, see alignment E=1.2e-78 PF16363: GDP_Man_Dehyd" amino acids 5 to 327 (323 residues), 313.6 bits, see alignment E=6.3e-97 PF01073: 3Beta_HSD" amino acids 5 to 238 (234 residues), 51.9 bits, see alignment E=1.7e-17 PF07993: NAD_binding_4" amino acids 74 to 189 (116 residues), 29.5 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 99% identical to RMLB2_ECOLI: dTDP-glucose 4,6-dehydratase 2 (rffG) from Escherichia coli (strain K12)

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 100% identity to etw:ECSP_4836)

MetaCyc: 99% identical to dTDP-glucose 4,6-dehydratase 2 (Escherichia coli K-12 substr. MG1655)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>JDDGAC_18185 dTDP-glucose 4,6-dehydratase (Escherichia coli ECRC98)
MRKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDI
CDRAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALT
EDKKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGL
PTLITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVA
TTGKVGETYNIGGHNERKNLDVVETICELLEELAPNKPQGVVHYRDLITFVADRPGHDLR
YAIDASKIARELGWLPQETFESGMRKTVQWYLANESWRKQVQDGSYQGERLGLKG