Protein Info for JDDGAC_17930 in Escherichia coli ECRC98

Name: ubiE
Annotation: bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF01209: Ubie_methyltran" amino acids 15 to 250 (236 residues), 379.9 bits, see alignment E=1.6e-117 TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase" amino acids 25 to 250 (226 residues), 297.3 bits, see alignment E=2.8e-93 PF13489: Methyltransf_23" amino acids 50 to 233 (184 residues), 59.8 bits, see alignment E=1.1e-19 PF01135: PCMT" amino acids 61 to 168 (108 residues), 28.4 bits, see alignment E=5.4e-10 PF13847: Methyltransf_31" amino acids 63 to 184 (122 residues), 81.4 bits, see alignment E=2.4e-26 PF13649: Methyltransf_25" amino acids 67 to 164 (98 residues), 86.2 bits, see alignment E=8e-28 PF08242: Methyltransf_12" amino acids 68 to 166 (99 residues), 52.6 bits, see alignment E=2.5e-17 PF08241: Methyltransf_11" amino acids 68 to 168 (101 residues), 82.5 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 100% identical to UBIE_ECOLC: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 100% identity to eco:b3833)

MetaCyc: 100% identical to bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinol methylase and demethylmenaquinone methyltransferase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYL-METHOXY-BENZOQ-METH-RXN [EC: 2.1.1.201]; ADOMET-DMK-METHYLTRANSFER-RXN [EC: 2.1.1.201, 2.1.1.163]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>JDDGAC_17930 bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE (Escherichia coli ECRC98)
MVDKSQETTHFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSG
VRRGQTVLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMGREKLRNIGVIGNVEYV
QANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLS
KAYDAYSFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTA
GVVALHRGYKF