Protein Info for JDDGAC_17240 in Escherichia coli ECRC98
Name: pflC
Annotation: [formate-C-acetyltransferase]-activating enzyme
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to PFLC_ECOLI: Pyruvate formate-lyase 2-activating enzyme (pflC) from Escherichia coli (strain K12)
KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 99% identity to eco:b3952)Predicted SEED Role
"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)
MetaCyc Pathways
- superpathway of N-acetylneuraminate degradation (22/22 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
- mixed acid fermentation (16/16 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (8/9 steps found)
- pyruvate fermentation to acetate IV (3/3 steps found)
- pyruvate fermentation to ethanol I (3/3 steps found)
- reductive monocarboxylic acid cycle (2/2 steps found)
- (S)-lactate fermentation to propanoate, acetate and hydrogen (9/13 steps found)
Isozymes
Compare fitness of predicted isozymes for: 1.97.1.4
Use Curated BLAST to search for 1.97.1.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (292 amino acids)
>JDDGAC_17240 [formate-C-acetyltransferase]-activating enzyme (Escherichia coli ECRC98) MTSSAGQRISCNVVETRRNDVARIFNIQRYSLNDGEGIRTVVFFKGCPHLCPWCANPESI SGKIQTVRREAKCLHCAKCLRDADECPSGAFERIGRDISLDALEREVMKDDIFFRTSGGG VTLSGGEVLMQAEFATRFLQRLRLWGVSCAIETAGDAPASKLLPLAKLCDEVLFDLKIMD ATQARDVVKMNLPRVLENLRLLVSEGVNVIPRLPLIPGFTLSRENMQQALDVLIPLKIRQ IHLLPFHQYGEPKYRLLGKTWSMKEVPAPSSADVTTMREMAERAGFQVTVGG