Protein Info for JDDGAC_17075 in Escherichia coli ECRC98

Name: nusG
Annotation: transcription termination/antitermination protein NusG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF02357: NusG" amino acids 7 to 112 (106 residues), 103.1 bits, see alignment E=9.8e-34 TIGR00922: transcription termination/antitermination factor NusG" amino acids 9 to 180 (172 residues), 239.1 bits, see alignment E=1.3e-75 PF00467: KOW" amino acids 130 to 159 (30 residues), 32.4 bits, see alignment 5.6e-12

Best Hits

Swiss-Prot: 100% identical to NUSG_ECOLI: Transcription termination/antitermination protein NusG (nusG) from Escherichia coli (strain K12)

KEGG orthology group: K02601, transcriptional antiterminator NusG (inferred from 100% identity to eco:b3982)

Predicted SEED Role

"Transcription antitermination protein NusG" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>JDDGAC_17075 transcription termination/antitermination protein NusG (Escherichia coli ECRC98)
MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKS
ERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPISDKEVDAIMNRLQQVGD
KPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEK
A