Protein Info for JDDGAC_16945 in Escherichia coli ECRC98

Name: zraR
Annotation: sigma-54-dependent response regulator transcription factor ZraR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF00072: Response_reg" amino acids 8 to 117 (110 residues), 109.4 bits, see alignment E=3.4e-35 PF00158: Sigma54_activat" amino acids 141 to 308 (168 residues), 240.9 bits, see alignment E=1.9e-75 PF14532: Sigma54_activ_2" amino acids 142 to 312 (171 residues), 75.7 bits, see alignment E=1.4e-24 PF07728: AAA_5" amino acids 165 to 283 (119 residues), 31.5 bits, see alignment E=5.1e-11 PF02954: HTH_8" amino acids 403 to 440 (38 residues), 55.5 bits, see alignment 1.1e-18

Best Hits

Swiss-Prot: 100% identical to ZRAR_ECO57: Transcriptional regulatory protein ZraR (zraR) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eok:G2583_4822)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>JDDGAC_16945 sigma-54-dependent response regulator transcription factor ZraR (Escherichia coli ECRC98)
MTHDNIDILVVDDDISHCTILQALLRGWGYNVALANSGRQALEQVRERVFDLVLCDVRMA
EMDGIATLKEIKALNPAIPVLIMTAYSSVETAVEALKTGALDYLIKPLDFDNLQATLEKA
LAHTHIIDAETPAVTASQFGMVGKSPAMQHLLSEIALVAPSEATVLIHGDSGTGKELVAR
AIHASSARSEKPLVTLNCAALNESLLESELFGHEKGAFTGADKRREGRFVEADGGTLFLD
EIGDISPMMLVRLLRAIQEREVQRVGSNQTISVDVRLIAATHRDLAAEVNAGRFRQDLYY
RLNVVAIEVPSLRQWREDIPLLAGHFLQRFAERNRKAVKGFTPQAMDLLIHYDWPGNIRE
LENAVERAVVLLTGEYISERELPLAIASTPIPLAQSLDIQPLVEVEKEVILAALEKTGGN
KTEAARQLGITRKTLLAKLSR