Protein Info for JDDGAC_16485 in Escherichia coli ECRC98

Name: espX5
Annotation: T3SS effector pentapeptide repeat protein EspX5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 PF00805: Pentapeptide" amino acids 163 to 197 (35 residues), 26.8 bits, see alignment 4.5e-10 amino acids 268 to 304 (37 residues), 29 bits, see alignment 9.3e-11 amino acids 309 to 345 (37 residues), 16 bits, see alignment 1.1e-06

Best Hits

Swiss-Prot: 96% identical to YJCF_ECOLI: Uncharacterized protein YjcF (yjcF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_5571)

Predicted SEED Role

"FIG00638091: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>JDDGAC_16485 T3SS effector pentapeptide repeat protein EspX5 (Escherichia coli ECRC98)
MRYNGLNNMFFPLCLINDNHSVTSLSHTKKTKSDNYSKHHKNTLIDNKALSLFKMDDHEK
VIDLIQKMKRIYDSLPSGKITKETDRKIHKYFIDIASYANNKCDDRITRRVYLNKDKEVS
IKVVYFINNVTVHNNTIEIPQTVNGGYDFSHLSLKGIVIKDEDLSNSNFAGCRLQNAIFQ
DCNMYKTNFNFAIMEKILFDNCILDDSYFAQIKMTDGTLNSCSAMHVQFYNATMNRANIK
NTFLDYSNFYMAYMAEVNLYKVIAPYINLFRADLSFSKLDLINFKHADLSRVNLNKAILQ
NINLIDSKLFFTRLTNTFLEMVICTDSNMANVNFNNANLNNCHFNCSVLTKAWMFNTRLY
RVNFDEASVQGMGISILRGEENIPINSDTLVTLQKFFEEDCTSHTGMSQTENNTHEVAMK
ITADIMQHAD