Protein Info for JDDGAC_16435 in Escherichia coli ECRC98

Name: nrfF
Annotation: heme lyase NrfEFG subunit NrfF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 signal peptide" amino acids 9 to 19 (11 residues), see Phobius details transmembrane" amino acids 20 to 34 (15 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 220 to 236 (17 residues), see Phobius details amino acids 247 to 273 (27 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 321 to 345 (25 residues), see Phobius details amino acids 364 to 382 (19 residues), see Phobius details amino acids 390 to 410 (21 residues), see Phobius details amino acids 515 to 533 (19 residues), see Phobius details TIGR00353: cytochrome c-type biogenesis protein CcmF" amino acids 24 to 378 (355 residues), 610.5 bits, see alignment E=1.9e-187 PF01578: Cytochrom_C_asm" amino acids 60 to 266 (207 residues), 171.2 bits, see alignment E=2.5e-54 PF16327: CcmF_C" amino acids 289 to 392 (104 residues), 79.4 bits, see alignment E=3.2e-26 amino acids 388 to 531 (144 residues), 126.6 bits, see alignment E=1.3e-40

Best Hits

Swiss-Prot: 98% identical to NRFE_ECOLI: Probable cytochrome c-type biogenesis protein NrfE (nrfE) from Escherichia coli (strain K12)

KEGG orthology group: K04016, formate-dependent nitrite reductase, possible assembly protein (inferred from 100% identity to ece:Z5673)

Predicted SEED Role

"Cytochrome c-type heme lyase subunit nrfE, nitrite reductase complex assembly" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (540 amino acids)

>JDDGAC_16435 heme lyase NrfEFG subunit NrfF (Escherichia coli ECRC98)
LRWPAMMRLTCIGILAQFALLLLAFGVLTYCFLISDFSVIYVAQHSYSLLSWKLKLAAVW
GGHEGSLLLWVLLLSAWSALFAWQYRQQTDPLFPLTLAVLSLMLAALLLFVVLWSDPFVR
IFPPAIEGRDLNPMLQHPGLIFHPPLLYLGYGGLMVAASVALASLLRGEFDGACARICWR
WALPGWSALTAGIILGSWWAYCELGWGGWWFWDPVENASLLPWLSATALLHSLSLTRQRG
IFRHWSLLLAIVTLMLSLLGTLIVRSGILVSVHAFALDNVRAVPLFSLFALISLASLALY
GWRARDGGPAVRFSGLSREMLILATLLLFCAVLLIVLVGTLYPMIYGLLGWGRLSVGAPY
FNRATLPFGLLMLVVIVLATFVSGKRAQLPALLAHAGILLFAAGIVVSSVSRQEISLNLQ
PGQQVTLAGYTFRFERLDLQAKGNYTSEKAIVALFDHQQRIGELTPERRFYEARRQQMME
PSIRWNGIHDWYAVMGEKTGADRYAFRLYVQSGVRWIWGGGLLMIAGALLSGWRGKKRDV