Protein Info for JDDGAC_16280 in Escherichia coli ECRC98

Name: phnF
Annotation: phosphonate metabolism transcriptional regulator PhnF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR02325: phosphonate metabolism transcriptional regulator PhnF" amino acids 6 to 241 (236 residues), 349 bits, see alignment E=6.6e-109 PF00392: GntR" amino acids 14 to 75 (62 residues), 76.4 bits, see alignment E=1.7e-25 PF01047: MarR" amino acids 39 to 69 (31 residues), 24.6 bits, see alignment 2.8e-09 PF07702: UTRA" amino acids 97 to 235 (139 residues), 109.6 bits, see alignment E=1.7e-35

Best Hits

Swiss-Prot: 100% identical to PHNF_ECOLI: Probable transcriptional regulator PhnF (phnF) from Escherichia coli (strain K12)

KEGG orthology group: K02043, GntR family transcriptional regulator, phosphonate transport system regulatory protein (inferred from 100% identity to eco:b4102)

Predicted SEED Role

"Transcriptional regulator PhnF" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>JDDGAC_16280 phosphonate metabolism transcriptional regulator PhnF (Escherichia coli ECRC98)
MHLSTHPTSYPTRYQEIAAKLEQELRQHYRCGDYLPAEQQLAARFEVNRHTLRRAIDQLV
EKGWVQRRQGVGVLVLMRPFDYPLNAQARFSQNLLDQGSHPTSEKLLSVLRPASGHVADA
LGITEGENVIHLRTLRRVNGIALCLIDHYFADLTLWPTLQRFDSGSLHDFLREQTGIALR
RSQTRISARRAQAKECQRLEIPNMSPLLCVRTLNHRDGESSPAEYSVSLTRADMIEFTME
H