Protein Info for JDDGAC_15995 in Escherichia coli ECRC98

Name: frdD
Annotation: fumarate reductase subunit FrdD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 transmembrane" amino acids 12 to 42 (31 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details PF02313: Fumarate_red_D" amino acids 6 to 116 (111 residues), 163.3 bits, see alignment E=1.2e-52

Best Hits

Swiss-Prot: 100% identical to FRDD_ECODH: Fumarate reductase subunit D (frdD) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K00247, fumarate reductase subunit D (inferred from 100% identity to eco:b4151)

MetaCyc: 100% identical to fumarate reductase membrane protein FrdD (Escherichia coli K-12 substr. MG1655)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Fumarate reductase subunit D" in subsystem Succinate dehydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (119 amino acids)

>JDDGAC_15995 fumarate reductase subunit FrdD (Escherichia coli ECRC98)
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ
SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI