Protein Info for JDDGAC_15485 in Escherichia coli ECRC98

Name: tabA
Annotation: toxin-antitoxin biofilm protein TabA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 TIGR00022: YhcH/YjgK/YiaL family protein" amino acids 1 to 150 (150 residues), 210.6 bits, see alignment E=5e-67 PF04074: DUF386" amino acids 1 to 147 (147 residues), 149.4 bits, see alignment E=3.7e-48

Best Hits

Swiss-Prot: 99% identical to TABA_SHIFL: Toxin-antitoxin biofilm protein TabA homolog (tabA) from Shigella flexneri

KEGG orthology group: None (inferred from 99% identity to eco:b4252)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>JDDGAC_15485 toxin-antitoxin biofilm protein TabA (Escherichia coli ECRC98)
MIIGNIHNLQPWLPQELRQAIEHIKAHVTAETPKGKHDIEGNRLFYLISEDMTEPYEARR
AEYHARYLDIQIVLKGQEGMTFSTQPAGTPDTDWLADKDIAFLPEGVDEKTVILNEGDFV
VFYPGEVHKPLCAVGAPAQVRKAVVKMLMA