Protein Info for JDDGAC_15125 in Escherichia coli ECRC98

Name: hypT
Annotation: hypochlorite stress DNA-binding transcriptional regulator HypT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF03466: LysR_substrate" amino acids 38 to 236 (199 residues), 92.9 bits, see alignment E=9.3e-31

Best Hits

Swiss-Prot: 100% identical to QSED_ECO57: HTH domain-truncated transcriptional regulator QseD (qseD) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to eci:UTI89_C5037)

Predicted SEED Role

"LysR family transcriptional regulator QseA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>JDDGAC_15125 hypochlorite stress DNA-binding transcriptional regulator HypT (Escherichia coli ECRC98)
VTPLQLSEQGKIFHSQIRHLLQQLESNLAELRGGSDYAQRKIKIAAAHSLSLGLLPSIIS
QMPPLFTWAIEAIDVDEAVDKLREGQSDCIFSFHDEDLLEAPFDHIRLFESQLFPVCASD
EHGEALFDLVQPHFPLLNYSRNSYMGRLINRTLTRHSELSFSTFFVSSMSELLKQVALDG
CGIAWLPEYAIQQEIRSGQLVVLNRDELVIPIQAYAYRMNTRMNPVAERFWRELRELEIV
LS