Protein Info for JDDGAC_14640 in Escherichia coli ECRC98

Name: dnaJ
Annotation: molecular chaperone DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00226: DnaJ
  • amino acids 5 to 67 (63 residues), 101.8 bits, E=2.7e-33
• TIGR02349: chaperone protein DnaJ
  • amino acids 5 to 347 (343 residues), 476.9 bits, E=2.4e-147
• PF01556: DnaJ_C
  • amino acids 117 to 330 (214 residues), 187.2 bits, E=2.8e-59
• PF00684: DnaJ_CXXCXGXG
  • amino acids 144 to 204 (61 residues), 68.2 bits, E=9.2e-23

Best Hits

Swiss-Prot: 100% identical to DNAJ_ECO81: Chaperone protein DnaJ (dnaJ) from Escherichia coli O81 (strain ED1a)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 100% identity to etw:ECSP_0015)

MetaCyc: 100% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Protein Sequence (376 amino acids)

>JDDGAC_14640 molecular chaperone DnaJ (Escherichia coli ECRC98)
MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS
QKRAAYDQYGHAAFEQGGMGGGGFGGGADFSDIFGDVFGDIFGGGRGRQRAARGADLRYN
MELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMRQGFFAVQ
QTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLAGEGEAGEHGAP
AGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRVKLKVPGETQTG
KLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQLLQELQESFGGPTGEHNSPRS
KSFFDGVKKFFDDLTR