Protein Info for JDDGAC_14620 in Escherichia coli ECRC98

Name: nhaR
Annotation: transcriptional activator NhaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF00126: HTH_1" amino acids 7 to 65 (59 residues), 62 bits, see alignment E=4.3e-21 PF03466: LysR_substrate" amino acids 97 to 285 (189 residues), 39.7 bits, see alignment E=3.5e-14

Best Hits

Swiss-Prot: 100% identical to NHAR_ECOLI: Transcriptional activator protein NhaR (nhaR) from Escherichia coli (strain K12)

KEGG orthology group: K03717, LysR family transcriptional regulator, transcriptional activator of nhaA (inferred from 100% identity to eco:b0020)

Predicted SEED Role

"Transcriptional activator NhaR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>JDDGAC_14620 transcriptional activator NhaR (Escherichia coli ECRC98)
MSHINYNHLYYFWHVYKEGSVVGAAEALYLTPQTITGQIRALEERLQGKLFKRKGRGLEP
SELGELVYRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADVLSKRLVSSVLNAAVVEGE
PIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLFSVRIGECGVSFWCTNPPPE
KPFPACLEERRLLIPGRRSMLGRKLLNWFNSQGLNVEILGEFDDAALMKAFGAMHNAIFV
APTLYAYDFYADKTVVEIGRVENVMEEYHAIFAERMIQHPAVQRICNTDYSALFSPAVR