Protein Info for JDDGAC_14550 in Escherichia coli ECRC98

Name: dapB
Annotation: 4-hydroxy-tetrahydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase" amino acids 6 to 269 (264 residues), 374.2 bits, see alignment E=2e-116 PF01113: DapB_N" amino acids 6 to 129 (124 residues), 145.2 bits, see alignment E=1.1e-46 PF05173: DapB_C" amino acids 132 to 268 (137 residues), 163.5 bits, see alignment E=2.5e-52

Best Hits

Swiss-Prot: 100% identical to DAPB_ECO5E: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 99% identity to eco:b0031)

MetaCyc: 99% identical to 4-hydroxy-tetrahydrodipicolinate reductase (Escherichia coli K-12 substr. MG1655)
RXN-14014 [EC: 1.17.1.8]

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>JDDGAC_14550 4-hydroxy-tetrahydrodipicolinate reductase (Escherichia coli ECRC98)
MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV
TVQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD
IAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAH
ALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSR
MTFANGAVRSALWLSGKENGLFDMRDVLDLNNL