Protein Info for JDDGAC_14350 in Escherichia coli ECRC98

Name: thiB
Annotation: thiamine ABC transporter substrate binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01276: thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin pyrophospate-binding protein" amino acids 6 to 327 (322 residues), 644.1 bits, see alignment E=4.3e-198 TIGR01254: ABC transporter periplasmic binding protein, thiB subfamily" amino acids 18 to 321 (304 residues), 518.1 bits, see alignment E=7.6e-160 PF01547: SBP_bac_1" amino acids 39 to 272 (234 residues), 71.1 bits, see alignment E=2.5e-23 PF13531: SBP_bac_11" amino acids 65 to 274 (210 residues), 47.9 bits, see alignment E=2.3e-16 PF13343: SBP_bac_6" amino acids 73 to 288 (216 residues), 58 bits, see alignment E=1.5e-19

Best Hits

Swiss-Prot: 99% identical to THIB_ECOLI: Thiamine-binding periplasmic protein (thiB) from Escherichia coli (strain K12)

KEGG orthology group: K02064, thiamine transport system substrate-binding protein (inferred from 99% identity to eco:b0068)

MetaCyc: 99% identical to thiamine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-32-RXN [EC: 7.6.2.15]

Predicted SEED Role

"Thiamin ABC transporter, substrate-binding component" in subsystem Thiamin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>JDDGAC_14350 thiamine ABC transporter substrate binding subunit (Escherichia coli ECRC98)
VLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDG
VSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDIFVPF
DYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAP
QAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGH
YLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPA
TTLEFTPAEVAAQRQAWISEWQRAVSR