Protein Info for JDDGAC_12890 in Escherichia coli ECRC98

Name: paoB
Annotation: aldehyde oxidoreductase FAD-binding subunit PaoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00941: FAD_binding_5
  • amino acids 3 to 220 (218 residues), 139.5 bits, E=5e-45

Best Hits

Swiss-Prot: 100% identical to PAOB_ECO57: Aldehyde oxidoreductase FAD-binding subunit PaoB (paoB) from Escherichia coli O157:H7

KEGG orthology group: K11178, xanthine dehydrogenase YagS FAD-binding subunit [EC: 1.17.1.4] (inferred from 99% identity to eco:b0285)

MetaCyc: 99% identical to aldehyde dehydrogenase, FAD-binding Fe-S subunit (Escherichia coli K-12 substr. MG1655)
Carboxylate reductase. [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, FAD binding subunit YagS" in subsystem Purine Utilization

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (11/11 steps found)
• adenosine nucleotides degradation II (5/5 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• superpathway of purines degradation in plants (13/18 steps found)
• ureide biosynthesis (5/7 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• caffeine degradation III (bacteria, via demethylation) (1/7 steps found)
• theophylline degradation (1/9 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (1/10 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4 or 1.2.99.6

Protein Sequence (318 amino acids)

>JDDGAC_12890 aldehyde oxidoreductase FAD-binding subunit PaoB (Escherichia coli ECRC98)
MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETPTHLIDVNGLGLDKIE
VTDAGGLRIGALVRNTDLVAHERVRRDYAVLSRALLAGASGQLRNQATTAGNLLQRTRCP
YFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPSDMAVAMRLLDAVVETIT
PEGKTRSITLADFYHPPGKTPHIETALLPGELIVAVTLPPPLGGKHIYRKVRDRASYAFA
LVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQAVYDALFASAHPTAENTFKL
LLAKRTLASVLAEARAQA