Protein Info for JDDGAC_12855 in Escherichia coli ECRC98

Name: ecpB
Annotation: fimbrial chaperone EcpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF18649: EcpB_C" amino acids 150 to 221 (72 residues), 111.1 bits, see alignment E=1e-36

Best Hits

Swiss-Prot: 100% identical to ECPB_ECO57: Probable fimbrial chaperone EcpB (ecpB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to eco:b0292)

Predicted SEED Role

"CFA/I fimbrial auxiliary subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>JDDGAC_12855 fimbrial chaperone EcpB (Escherichia coli ECRC98)
MKKHLLLLALLLSGISPAQALDVGDISSFMNSDSSTLSKTIKNSTDSGRLINIRLERLSS
PLDDGQVISMDKPDELLLTPASLLLPAQASEVIRFFYKGPADEKERYYRIVWFDQALSDA
QRDNANRSAVATASARIGTILVVAPRQANYHFQYANGTLTNTGNATLRILAYGPCLKAAN
GKECKENYYLMPGKSRRFTRVDTADNKGRVALWQGDKFIPVK