Protein Info for JDDGAC_12385 in Escherichia coli ECRC98

Name: fbpC
Annotation: ferric ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 23 to 164 (142 residues), 138.1 bits, E=3.2e-44
• PF08402: TOBE_2
  • amino acids 273 to 344 (72 residues), 46.1 bits, E=4.4e-16

Best Hits

Swiss-Prot: 100% identical to FBPC_ECO57: Fe(3+) ions import ATP-binding protein FbpC (fbpC) from Escherichia coli O157:H7

KEGG orthology group: K02010, iron(III) transport system ATP-binding protein [EC: 3.6.3.30] (inferred from 100% identity to ecs:ECs0413)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.30

Protein Sequence (348 amino acids)

>JDDGAC_12385 ferric ABC transporter ATP-binding protein (Escherichia coli ECRC98)
MSQKNFVELRNVTKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGKTTILRLVAGLEKPSE
GQIFIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGENVGYGLKMLGVSRSEVKQRVKEA
LAMVDLEGFEDRYVDQISGGQQQRVALARALILKPKVLLFDEPLSNLDANLRRSMRDKIR
ELQKQFNITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQDLYRQPASRFMASFMGDA
NLFPANFSEEYVDIYGYRLPRAAHFPVQGSGTVGVRPEAITLSNHGEESQRCVIRHVAYM
GPQYEVTVEWHGQEILLQVNATRLQPDIGEHYYLEIHPYGMFVLADAA