Protein Info for JDDGAC_11860 in Escherichia coli ECRC98

Annotation: Efflux pump membrane transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 655 transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 480 to 498 (19 residues), see Phobius details amino acids 505 to 525 (21 residues), see Phobius details amino acids 531 to 554 (24 residues), see Phobius details amino acids 581 to 601 (21 residues), see Phobius details amino acids 613 to 635 (23 residues), see Phobius details TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 1 to 654 (654 residues), 1177.6 bits, see alignment E=0 PF00873: ACR_tran" amino acids 1 to 636 (636 residues), 883.6 bits, see alignment E=2.6e-269

Best Hits

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (655 amino acids)

>JDDGAC_11860 Efflux pump membrane transporter (Escherichia coli ECRC98)
MFGMVLAIGLLVDDAIVVVENVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFV
PMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLKPIAKGDHGEGKKGFFG
WFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPDEDQGVFMT
MVQLPAGATQERTQKVLNEVTHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDW
ADRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEK
LTQARNQLLAEAAKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAW
GGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSP
RLERYNGLPSMEILGQAAPGKSTGEAMELMEQLASKLPTGVGYDWTGMSYQERLSGNQAP
SLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTT
IGLSAKNAILIVEFAKDLMDKEGKGLIEATLDAVRMRLRPILMTSLAFILGVMPLVISTG
AGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVRRRFSRKNEDIEHNHTVDHH