Protein Info for JDDGAC_11680 in Escherichia coli ECRC98

Name: cueR
Annotation: Cu(I)-responsive transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF13411: MerR_1" amino acids 1 to 66 (66 residues), 68.4 bits, see alignment E=7.1e-23 TIGR02044: Cu(I)-responsive transcriptional regulator" amino acids 1 to 126 (126 residues), 206.4 bits, see alignment E=6.1e-66 PF00376: MerR" amino acids 2 to 39 (38 residues), 56.5 bits, see alignment E=2.8e-19 PF09278: MerR-DNA-bind" amino acids 45 to 108 (64 residues), 62.1 bits, see alignment E=9.2e-21

Best Hits

Swiss-Prot: 100% identical to CUER_ECO57: HTH-type transcriptional regulator CueR (cueR) from Escherichia coli O157:H7

KEGG orthology group: K11923, MerR family transcriptional regulator, copper efflux regulator (inferred from 99% identity to eco:b0487)

Predicted SEED Role

"HTH-type transcriptional regulator cueR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>JDDGAC_11680 Cu(I)-responsive transcriptional regulator (Escherichia coli ECRC98)
MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLLRQARQVGFNL
EESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQSMRNQLLALANACPGDDSADC
PIIENLSGCCHHRAG