Protein Info for JDDGAC_11495 in Escherichia coli ECRC98

Name: arcC
Annotation: carbamate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 2 to 277 (276 residues), 94.5 bits, E=4.4e-31
• TIGR00746: carbamate kinase
  • amino acids 2 to 296 (295 residues), 420.7 bits, E=1.5e-130

Best Hits

Swiss-Prot: 100% identical to ARCC_ECO57: Carbamate kinase (arcC) from Escherichia coli O157:H7

KEGG orthology group: K00926, carbamate kinase [EC: 2.7.2.2] (inferred from 100% identity to eok:G2583_0641)

MetaCyc: 45% identical to carbamate kinase (Halobacterium salinarum)
Carbamate kinase. [EC: 2.7.2.2, 6.3.4.16, 6.3.5.5]

Predicted SEED Role

"Carbamate kinase (EC 2.7.2.2)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or MLST or Polyamine Metabolism (EC 2.7.2.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• allantoin degradation IV (anaerobic) (8/9 steps found)
• L-citrulline degradation (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• UMP biosynthesis III (5/6 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• urea cycle (3/5 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutamate metabolism
• Nitrogen metabolism
• Purine metabolism
• Pyrimidine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.2, 6.3.5.5

Use Curated BLAST to search for 2.7.2.2 or 6.3.4.16 or 6.3.5.5

Protein Sequence (297 amino acids)

>JDDGAC_11495 carbamate kinase (Escherichia coli ECRC98)
MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRLAIVHGNGPQVGLLAL
QNLAWKEVEPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTVRTRIEVSPDDPAFLQP
EKFIGPVYQPEEQEALEAAYGWQMKRDGKYLRRVVASPQPRKILDSEAIELLLKEGHVVI
CSGGGGVPVTDDGAGSEAVIDKDLAAALLAEQINADGLVILTDADAVYENWGMPQQRAIR
HATPDELAPFAKADGSMGPKVTAVSGYVRSRGKPAWIGALSRIEETLAGEAGTCISL