Protein Info for JDDGAC_11360 in Escherichia coli ECRC98

Name: vgrG
Annotation: type VI secretion system tip protein VgrG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 TIGR03361: type VI secretion system Vgr family protein" amino acids 7 to 517 (511 residues), 628.3 bits, see alignment E=9.3e-193 TIGR01646: Rhs element Vgr protein" amino acids 20 to 500 (481 residues), 441.6 bits, see alignment E=4.1e-136 PF05954: Phage_GPD" amino acids 28 to 327 (300 residues), 257.5 bits, see alignment E=1.7e-80 PF04717: Phage_base_V" amino acids 384 to 450 (67 residues), 54.7 bits, see alignment E=1.1e-18

Best Hits

KEGG orthology group: K11904, type VI secretion system secreted protein VgrG (inferred from 100% identity to ecs:ECs0607)

Predicted SEED Role

"VgrG-3 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (633 amino acids)

>JDDGAC_11360 type VI secretion system tip protein VgrG (Escherichia coli ECRC98)
MSTGLRFTLEVDGLPPDAFAVVSFHLTQSLSSLFSLDLSLVSQQFLSLEFAQVLDKMAYL
TIWQGDDVQRRVKGVVTWFELGENDKNQMLYSMKVHPPLWRAGLRQNFRIFQNEDIKSIL
GTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAEEGIFFYEEHAYKSTDQS
LVLCDTVRHLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRPSSVVTKDYTFKRPGWAGR
FDQEGQHQDYQRTQYEVYDYPGRFKGAHGQNFARWQMEGWRNNAETARGMSRSPEIWPGR
RIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGAGTALENHFAVIPADRTWRPQPRL
KPLVDGPQSAVVTGPEGEEIFCDEHGRVRVKFNWDRYNPADQDSSCWIRVAQAWAGTGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPGSLPGTKTQMTIRSKTYMGSGFN
ELKFDDATGREQVYIHAQKNMDTEVLNDRTTTVKHDHRETVKNDQTVTIQEGNRLLTVEK
GHKITGVLKGSLSEDVFQDRGTIAGSVHVDAVNNGGEGNGIQAYTAIKEIMLAVEESKIA
LTPDGIQLQVGESTVIRLSKDGITIVGGSVFIN