Protein Info for JDDGAC_10905 in Escherichia coli ECRC98

Name: gltJ
Annotation: glutamate/aspartate ABC transporter permease GltJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 25 to 53 (29 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 147 to 161 (15 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 24 to 132 (109 residues), 54.4 bits, see alignment E=7.5e-19 PF00528: BPD_transp_1" amino acids 45 to 238 (194 residues), 95.1 bits, see alignment E=2.2e-31

Best Hits

Swiss-Prot: 99% identical to GLTJ_ECOLI: Glutamate/aspartate import permease protein GltJ (gltJ) from Escherichia coli (strain K12)

KEGG orthology group: K10003, glutamate/aspartate transport system permease protein (inferred from 99% identity to eco:b0654)

MetaCyc: 99% identical to glutamate/aspartate ABC transporter membrane subunit GltJ (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>JDDGAC_10905 glutamate/aspartate ABC transporter permease GltJ (Escherichia coli ECRC98)
MSIDWNWGIFLQQAPFGNTTYLGWIWSGFQVTIALSICAWIIAFLVGSFFGILRTVPNRF
LSGLGTLYVELFRNVPLIVQFFTWYLVIPELLPEKIGMWFKAELDPNIQFFLSSMLCLGL
FTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRYVLLPNAYRVIVPPMTSEMMNLV
KNSAIASTIGLVDMAAQASKLLDYSAHAWESFTAITLAYVFINAFIMLVMTLVERKVRLP
GNMGGK