Protein Info for JDDGAC_10320 in Escherichia coli ECRC98

Name: ybhH
Annotation: 4-oxalomesaconate tautomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04303: PrpF
  • amino acids 1 to 350 (350 residues), 556.9 bits, E=9.9e-172

Best Hits

Swiss-Prot: 99% identical to YBHH_ECOL6: Putative isomerase YbhH (ybhH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K09788, hypothetical protein (inferred from 99% identity to eco:b0769)

MetaCyc: 50% identical to 4-oxalomesaconate tautomerase (Pseudomonas putida KT2440)
RXN-9983 [EC: 5.3.2.8]

Predicted SEED Role

"FIG00637898: hypothetical protein"

MetaCyc Pathways

• gallate degradation I (1/4 steps found)
• methylgallate degradation (2/6 steps found)
• gallate degradation II (1/5 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
• superpathway of vanillin and vanillate degradation (3/10 steps found)
• syringate degradation (3/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.2.8

Protein Sequence (350 amino acids)

>JDDGAC_10320 4-oxalomesaconate tautomerase (Escherichia coli ECRC98)
MKKIPCVMMRGGTSRGAFLLAEHLPEDQTQRDKILMAIMGSGNDLEIDGIGGGNPLTSKV
AIISRSSDPRADVDYLFAQVIVHEKRVDTTPNCGNMLSGVGAFAIENGLIAATSPVTRVR
IRNVNTGTFIEADVQTPNGVVEYEGSARIDGVPGTAAPVALTFLNAAGTKTGKVFPTDNQ
IDYFDDVPVTCIDMAMPVVIIPAEYLGKTGYELPAELDADKALLARIESIRLQAGKAMGL
GDVSNMVIPKPVLISPAQKGGAINVRYFMPHSCHRALAITGAIAISSSCALEGTVTRQIV
PSVGYGNINIEHPSGGLDVHLSNEGQDATTLRASVIRTTRKIFSGEVYLP