Protein Info for JDDGAC_10320 in Escherichia coli ECRC98
Name: ybhH
Annotation: 4-oxalomesaconate tautomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to YBHH_ECOL6: Putative isomerase YbhH (ybhH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: K09788, hypothetical protein (inferred from 99% identity to eco:b0769)MetaCyc: 50% identical to 4-oxalomesaconate tautomerase (Pseudomonas putida KT2440)
RXN-9983 [EC: 5.3.2.8]
Predicted SEED Role
"FIG00637898: hypothetical protein"
MetaCyc Pathways
- gallate degradation I (1/4 steps found)
- methylgallate degradation (2/6 steps found)
- gallate degradation II (1/5 steps found)
- protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
- superpathway of vanillin and vanillate degradation (3/10 steps found)
- syringate degradation (3/12 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 5.3.2.8
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (350 amino acids)
>JDDGAC_10320 4-oxalomesaconate tautomerase (Escherichia coli ECRC98) MKKIPCVMMRGGTSRGAFLLAEHLPEDQTQRDKILMAIMGSGNDLEIDGIGGGNPLTSKV AIISRSSDPRADVDYLFAQVIVHEKRVDTTPNCGNMLSGVGAFAIENGLIAATSPVTRVR IRNVNTGTFIEADVQTPNGVVEYEGSARIDGVPGTAAPVALTFLNAAGTKTGKVFPTDNQ IDYFDDVPVTCIDMAMPVVIIPAEYLGKTGYELPAELDADKALLARIESIRLQAGKAMGL GDVSNMVIPKPVLISPAQKGGAINVRYFMPHSCHRALAITGAIAISSSCALEGTVTRQIV PSVGYGNINIEHPSGGLDVHLSNEGQDATTLRASVIRTTRKIFSGEVYLP