Protein Info for JDDGAC_10020 in Escherichia coli ECRC98

Name: bioD
Annotation: dethiobiotin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF13500: AAA_26" amino acids 3 to 208 (206 residues), 149.1 bits, see alignment E=2.3e-47 TIGR00347: dethiobiotin synthase" amino acids 6 to 176 (171 residues), 226 bits, see alignment E=1.5e-71 PF01656: CbiA" amino acids 6 to 218 (213 residues), 68 bits, see alignment E=1.2e-22

Best Hits

Swiss-Prot: 99% identical to BIOD1_ECO57: ATP-dependent dethiobiotin synthetase BioD 1 (bioD1) from Escherichia coli O157:H7

KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 98% identity to eco:b0778)

MetaCyc: 98% identical to dethiobiotin synthetase (Escherichia coli K-12 substr. MG1655)
Dethiobiotin synthase. [EC: 6.3.3.3]

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.3.3

Use Curated BLAST to search for 6.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>JDDGAC_10020 dethiobiotin synthase (Escherichia coli ECRC98)
VSKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQ
RNSSLQLDYATVNPYTFAEPTSPHIISAQEGRSIESSVMSSGLRALEQQADWVLVEGAGG
WFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQAIQHAGLTLAGWVANDVTP
PGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL