Protein Info for JDDGAC_09980 in Escherichia coli ECRC98

Name: ybhL
Annotation: Inner membrane protein YbhL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details PF01027: Bax1-I" amino acids 18 to 230 (213 residues), 212.1 bits, see alignment E=3.9e-67

Best Hits

Swiss-Prot: 99% identical to YBHL_ECOL6: Inner membrane protein YbhL (ybhL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06890, (no description) (inferred from 100% identity to ece:Z1005)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>JDDGAC_09980 Inner membrane protein YbhL (Escherichia coli ECRC98)
MDRFPRSDSIVQPRAGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLI
GLIIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTA
GMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVG
LTAYDTQKLKNMGEQIDTRDASNLRKYSILCALTLYLDFINLFLMLLRIFGNRR