Protein Info for JDDGAC_09625 in Escherichia coli ECRC98

Name: ybjM
Annotation: Inner membrane protein YbjM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details PF11045: YbjM" amino acids 3 to 117 (115 residues), 178.2 bits, see alignment E=3.1e-57

Best Hits

Swiss-Prot: 99% identical to YBJM_ECO57: Inner membrane protein YbjM (ybjM) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to eco:b0848)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>JDDGAC_09625 Inner membrane protein YbjM (Escherichia coli ECRC98)
VKHKQRWAGAICCFVLFIVVCLFLATHMKGAFRAAGHPEIGLLFFILPGAVASFFSQRRE
VLKPLFGAMLAAPCSMLIMRLFFSPTRSFWQELAWLLSAVFWCALGALCFLFISSLFKPQ
HRKNQ