Protein Info for JDDGAC_09335 in Escherichia coli ECRC98

Name: ycaD
Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 42 to 65 (24 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details amino acids 351 to 369 (19 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 316 (305 residues), 97.5 bits, see alignment E=1.2e-31 amino acids 210 to 372 (163 residues), 55 bits, see alignment E=9.8e-19 PF06779: MFS_4" amino acids 28 to 363 (336 residues), 39.2 bits, see alignment E=8.3e-14 PF00083: Sugar_tr" amino acids 39 to 177 (139 residues), 30.4 bits, see alignment E=2.9e-11

Best Hits

Swiss-Prot: 100% identical to YCAD_ECO27: Uncharacterized MFS-type transporter YcaD (ycaD) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K08219, MFS transporter, UMF2 family, putative MFS family transporter protein (inferred from 100% identity to eco:b0898)

Predicted SEED Role

"Hypothetical MFS-type transporter protein YcaD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>JDDGAC_09335 MFS transporter (Escherichia coli ECRC98)
MSTYTRPVMLLLSGLLLLTLAIAVLNTLVPLWLAQEHMSTWQVGVVSSSYFTGNLVGTLL
TGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALM
CSGTSRNRGRLLAAYMMVYYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRV
LNQQAENHDSTSITSMLKLRQARLGVNGCIISGIVLGSLYGLMPLYLNHKGVSNASIGFW
MAVLVSAGILGQWPIGRLADKFGRLLVLRVQVFVVILGSIAMLSQAAMAPALFILGAAGF
TLYPVAMAWACEKVEHHQLVAMNQALLLSYTVGSLLGPSFTAMLMQNFSDNLLFIMIASV
SFIYLLMLLRNAGHTPKPVAHV