Protein Info for JDDGAC_08455 in Escherichia coli ECRC98

Name: sodC
Annotation: superoxide dismutase [Cu-Zn] SodC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00080: Sod_Cu
  • amino acids 40 to 174 (135 residues), 112.1 bits, E=1.4e-36

Best Hits

Swiss-Prot: 61% identical to SODC1_SALT4: Superoxide dismutase [Cu-Zn] 1 (sodC1) from Salmonella typhimurium (strain 4/74)

KEGG orthology group: K04565, Cu/Zn superoxide dismutase [EC: 1.15.1.1] (inferred from 99% identity to ecs:ECs1120)

MetaCyc: 59% identical to superoxide dismutase (Cu-Zn) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Cu-Zn] precursor (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• ethene biosynthesis III (microbes) (6/7 steps found)
• superoxide radicals degradation (2/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Protein Sequence (175 amino acids)

>JDDGAC_08455 superoxide dismutase [Cu-Zn] SodC (Escherichia coli ECRC98)
MKCKIIAAIAMLTAASCGYAAEQEVPMNLVSADGKEVSIGKITIQETPYGLLFTPALHSL
SEGIHGFHVHEKGNCAPALKDGKPVAALSAGGHFDPKNTDKHLGPWSPDGHLGDLPALFV
THDGKANYPVLAPRLNSLKEIKGRSLMLHAGGDNHHDHPEPLGGGGARMACGIIQ