Protein Info for JDDGAC_08165 in Escherichia coli ECRC98

Name: pgaD
Annotation: poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 transmembrane" amino acids 16 to 42 (27 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details TIGR03940: poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD" amino acids 3 to 126 (124 residues), 55.4 bits, see alignment E=3.2e-19 PF13994: PgaD" amino acids 4 to 125 (122 residues), 52.6 bits, see alignment E=2.7e-18

Best Hits

Swiss-Prot: 100% identical to PGAD_ECOLI: Biofilm PGA synthesis protein PgaD (pgaD) from Escherichia coli (strain K12)

KEGG orthology group: K11937, biofilm PGA synthesis protein PgaD (inferred from 100% identity to eco:b1021)

MetaCyc: 100% identical to poly-N-acetyl-D-glucosamine synthase subunit PgaD (Escherichia coli K-12 substr. MG1655)
2.4.1.M63 [EC: 2.4.1.M63]; TRANS-RXN0-549 [EC: 2.4.1.M63]

Predicted SEED Role

"Biofilm PGA synthesis auxiliary protein PgaD"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.M63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (137 amino acids)

>JDDGAC_08165 poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD (Escherichia coli ECRC98)
MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLL
AVANAVVLIVWALYNKLRFQKQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFT
SQGQIKMVVSEKALVRA