Protein Info for JDDGAC_08075 in Escherichia coli ECRC98

Name: acpS2
Annotation: putative holo-[acyl-carrier-protein] synthase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00556: phosphopantetheine--protein transferase domain
  • amino acids 1 to 121 (121 residues), 67 bits, E=1.8e-22
• PF01648: ACPS
  • amino acids 2 to 96 (95 residues), 67.5 bits, E=5e-23
• TIGR00516: holo-[acyl-carrier-protein] synthase
  • amino acids 2 to 121 (120 residues), 79.7 bits, E=2.3e-26

Best Hits

Swiss-Prot: 100% identical to ACPS2_ECO57: Probable holo-[acyl-carrier-protein] synthase 2 (acpS2) from Escherichia coli O157:H7

KEGG orthology group: K00997, holo-[acyl-carrier protein] synthase [EC: 2.7.8.7] (inferred from 100% identity to ecf:ECH74115_1283)

Predicted SEED Role

"Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.7.8.7)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• acyl carrier protein metabolism (2/2 steps found)
• acyl carrier protein activation (1/1 steps found)
• enterobactin biosynthesis (7/11 steps found)
• petrobactin biosynthesis (1/10 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.7

Use Curated BLAST to search for 2.7.8.7

Protein Sequence (122 amino acids)

>JDDGAC_08075 putative holo-[acyl-carrier-protein] synthase 2 (Escherichia coli ECRC98)
MRIGTDIVEIARITKAIINGEMAFYERVYTSHERLLINPAEPDYERASGFWAAKEALVKA
IGCGFRDGVRFQDIEIKHDAAKAPYFVISGRLQEIFIGQGLQNNSLSISHCRTHAIATVI
VY