Protein Info for JDDGAC_08025 in Escherichia coli ECRC98

Name: lolE
Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 298 to 320 (23 residues), see Phobius details amino acids 348 to 373 (26 residues), see Phobius details amino acids 401 to 422 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 44 to 268 (225 residues), 37.5 bits, see alignment E=3.2e-13 PF02687: FtsX" amino acids 303 to 429 (127 residues), 64.1 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to ecf:ECH74115_1293)

Predicted SEED Role

"FIG00639810: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>JDDGAC_08025 ABC transporter permease (Escherichia coli ECRC98)
MSGEILAVNCVLLLILFFVFYQLLFYSRDVKFAFLNLFRHKRRSFSTITAIVLGGVAIFL
YGGFIDYSFWILKEQTIRTNIGHVQIYNQHYFETSNKNKSLIADYAALKKAILSDPTLAA
DISTLSGQLEFTGVISHYESETSSYFSALGVEPLPALKLGSFDKIIAGSDLSRVKGDEIT
LGSGLAKTLNAKYDDWLDVMVVNTAGGQGALSLKMRGIFESGIKDYDDVAMKIPLDTAQR
MMGTDGVSKVLILLKEDDTAAFSAKLRQFIERNHLPLVVKDWRDVSLFYQQVEGLLSGIY
FFIKLIVALIVIFMIGNSMAMNIVERTREITTLRAIGLKPLHVTRLFLTEGIFIGVIGAV
GSLLVGGVLAWIINLYGIAMPPSPGQTIGYTAFIKTSNPELIWVTVVLPILTATGASVLP
ALRASRLNISDAFKFS